PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN03737.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YB
Protein Properties Length: 145aa    MW: 16249.2 Da    PI: 5.9865
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN03737.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB170.42e-5333128297
       NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                 +eqdr+lPianv+rimk++lP nakisk+aket+qe vsefisfvt+easdkc++ekrkt+ngdd++walatlGf+dy eplk yl kyre+ege+
  KHN03737.1  33 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQESVSEFISFVTGEASDKCHKEKRKTVNGDDICWALATLGFDDYSEPLKRYLYKYREMEGER 128
                 89********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.1E-5129136IPR009072Histone-fold
SuperFamilySSF471136.45E-4035140IPR009072Histone-fold
PfamPF008087.1E-2738102IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.2E-196684No hitNo description
PRINTSPR006153.2E-1985103No hitNo description
PRINTSPR006153.2E-19104122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MGDNIGKVLD REGFKYNFTA SASGTSAQDG VIKEQDRLLP IANVGRIMKQ ILPPNAKISK  60
EAKETMQESV SEFISFVTGE ASDKCHKEKR KTVNGDDICW ALATLGFDDY SEPLKRYLYK  120
YREMEGERAN QNKGSNGYEN NIANI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-4332123192Transcription factor HapC (Eurofung)
4g92_B1e-4332123192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150411e-115AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003536891.11e-105PREDICTED: nuclear transcription factor Y subunit B-5-like
SwissprotO822484e-60NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLA0A0B2P8101e-105A0A0B2P810_GLYSO; Nuclear transcription factor Y subunit B-5
TrEMBLI1L7X01e-105I1L7X0_SOYBN; Uncharacterized protein
STRINGGLYMA10G02480.11e-105(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.13e-61nuclear factor Y, subunit B5
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]